- LRRC40 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82185
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Unconjugated
- dJ677H15.1
- Human
- LRRC40
- This antibody was developed against Recombinant Protein corresponding to amino acids: GNPLRTIRRE IISKGTQEVL KYLRSKIKDD GPSQSESATE TAMTLPSESR VNIHAIITLK ILDYSDKQAT LIPDEVFDAV KSNIVTSINF
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- leucine rich repeat containing 40
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
GNPLRTIRREIISKGTQEVLKYLRSKIKDDGPSQSESATETAMTLPSESRVNIHAIITLKILDYSDKQATLIPDEVFDAVKSNIVTSINF
Specifications/Features
Available conjugates: Unconjugated